PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.CV4V1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 408aa    MW: 45418.3 Da    PI: 5.1255
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.CV4V1genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.51.7e-34206260155
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  kpr+rWtpeLHe+Fveav+qLGGsekAtPk +l+lmkvkgLt++hvkSHLQkYR+
  Araip.CV4V1 206 KPRMRWTPELHEAFVEAVNQLGGSEKATPKGVLNLMKVKGLTIYHVKSHLQKYRT 260
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.516203263IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-32204262IPR009057Homeodomain-like
SuperFamilySSF466894.48E-18204260IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-25206260IPR006447Myb domain, plants
PfamPF002497.5E-10208259IPR001005SANT/Myb domain
PfamPF143794.1E-20293337IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MSSSSPVLPT PLDNKYMKPP DSFQLSPIRE MTVNPSPLQS TSSNSNTRST GHTFSSPGVV  60
SFSSASQHER QHQPSSFVSQ TLGEDSVSSE LHSASFISQP QESDEISWGP DPFQDMLGFP  120
ENVSVQHDQV ENGACYTNDD NVKQSDFGEW VDKLMSIDDS YDPNWSQLLG DDNESEPKPK  180
PIQQQNVPSK EVKGLPSSPS TASQTKPRMR WTPELHEAFV EAVNQLGGSE KATPKGVLNL  240
MKVKGLTIYH VKSHLQKYRT ARYKPETPEG TSEKKLSSIE EMKSLDLKTS KGITEALRLQ  300
MELQKRLHEQ LEIQRKLQIQ IENQGKRLQM MFEQQREMGD SKFKDSSSSS LDEPSNSEAP  360
KEQNEKLGSG SCITKAGPGE SSWDESTKQE MADEAQVSVP PPTKRVKT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016205391.10.0PREDICTED: protein PHR1-LIKE 1
SwissprotQ8GUN55e-96PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A0B2RAD00.0A0A0B2RAD0_GLYSO; Myb family transcription factor APL
TrEMBLI1JRR70.0I1JRR7_SOYBN; PHR2
TrEMBLK7KGY40.0K7KGY4_SOYBN; Uncharacterized protein
STRINGGLYMA03G41040.30.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.22e-88G2-like family protein